PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v1914570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GRAS
Protein Properties Length: 592aa    MW: 67283.9 Da    PI: 5.1139
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v1914570.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS286.29e-882225902374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvsel.ykal.ppsetseknsseelaalkl.fsevsPilk 92 
                       e Ll+cAe +  ++ e+a++lL++ + l s++g p++R+++yf+eAL++ + +++ ++  k + + ++ ++++ ++ l+  +l f+e  P+ +
  Lj6g3v1914570.1 222 AESLLSCAEKIGYQQYERASKLLSHCKSLTSNRGGPVKRVVHYFAEALQHMIDKETGRVsIKEMqEIQKHDPEELTKDLNPITLlFYERLPFCQ 315
                      578***************************************************5544414555355555556666666666556********* PP

             GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak. 184
                      +s +t  qaI e v +++++H iD++i +G+QW +L++aL sR   +   l+iT++gs  ++s++e+e tge+L+ fA++l++pf+fnv++++ 
  Lj6g3v1914570.1 316 ISMFTGVQAIIENVTEAKKIHLIDLEIRKGAQWTTLMHALESRHdCPLELLKITAIGS-GTTSRHEIEDTGEKLKVFAKSLNIPFSFNVVIVSd 408
                      *******************************************9445569********.6679***************************7772 PP

             GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                       ++ ++ + + ++p+E++aV +++++    +e+ +le     ++++v++l+P v+vv+e ea+hns+sF++rf+eal y+sa+fd+lea + ++
  Lj6g3v1914570.1 409 MVDIITEDVFVIDPEETVAVYSQFAIRCKIQEPNQLEA----IMRMVRTLKPVVMVVAEIEANHNSTSFVKRFTEALFYFSAFFDCLEACMKHD 498
                      56666777779999************999988888888....**************************************************** PP

             GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvS 371
                      +++ri++E   lg  i+++va +++    r+ +   Wr+ ++++G+++ +ls     qa+l+ ++++ +   + + + ++l+ gWk+ p+ svS
  Lj6g3v1914570.1 499 EQNRIMIETL-LGHGIRSIVAERKS----RNVKIDVWRAYFSRFGMEETELSRVSLYQADLVAKRFPsGSCCTFHMDGHCLLVGWKGTPISSVS 587
                      *******998.*********96555....6999**********************************77779999******************* PP

             GRAS 372 aWr 374
                      +W+
  Lj6g3v1914570.1 588 VWK 590
                      **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.054195569IPR005202Transcription factor GRAS
PfamPF035143.1E-85222590IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 592 aa     Download sequence    Send to blast
MEEYYHFMEL SPSAVEDKFS SSNDILWATD VGLNEMKKVQ FSAECGGIDS PCLDYGFLSN  60
DPSEEEARFL LSTDQPKDHQ QPSYEPWDNL RFDMVSSPLQ IQVEDIMQID ENFSTKVPLF  120
YPAKNKQFPT PLAPIEILKH YGKGFKRLCD EGKILHPLDD SSAVITNVDG RKLSTEDVMR  180
VAGTKFIHSA SESPGLDLLV THPFGFSFSE LSIEEKEDAE LAESLLSCAE KIGYQQYERA  240
SKLLSHCKSL TSNRGGPVKR VVHYFAEALQ HMIDKETGRV SIKEMQEIQK HDPEELTKDL  300
NPITLLFYER LPFCQISMFT GVQAIIENVT EAKKIHLIDL EIRKGAQWTT LMHALESRHD  360
CPLELLKITA IGSGTTSRHE IEDTGEKLKV FAKSLNIPFS FNVVIVSDMV DIITEDVFVI  420
DPEETVAVYS QFAIRCKIQE PNQLEAIMRM VRTLKPVVMV VAEIEANHNS TSFVKRFTEA  480
LFYFSAFFDC LEACMKHDEQ NRIMIETLLG HGIRSIVAER KSRNVKIDVW RAYFSRFGME  540
ETELSRVSLY QADLVAKRFP SGSCCTFHMD GHCLLVGWKG TPISSVSVWK FT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-382195902375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003534817.10.0PREDICTED: DELLA protein RGL2-like
TrEMBLA0A0B2PYP40.0A0A0B2PYP4_GLYSO; DELLA protein RGL2
TrEMBLK7LBN10.0K7LBN1_SOYBN; Uncharacterized protein
STRINGGLYMA09G04110.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-56RGA-like 1